*Please note that we are currently updating our product labels to a new design, so during this transition period, you may receive products with either the old or new label depending on availability.
Wolverine Stack Peptide Bundle – BPC-157 & TB500
SKU: BPC157 10mg, TB500 10mg
Form: Lyophilized Powder
Included Compounds:
BPC-157
-
Molecular Formula: C₆₂H₉₈N₁₆O₂₂
-
Molecular Weight: 1419.54 g/mol
-
Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val
TB500
-
Molecular Formula: C₂₁₂H₃₅₀N₅₆O₇₈S
-
Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Product Description:
This Research Peptide Bundle includes BPC-157 and TB500 in lyophilized powder form. Both compounds are synthetic peptides provided exclusively for scientific research and laboratory use only.
These products are not intended for human or animal consumption, and are not approved for medical, therapeutic, diagnostic, or veterinary use under any circumstances.
Storage & Handling:
-
Lyophilized Storage: Store peptides at -20°C in a dry, desiccated environment.
-
After Reconstitution:
-
Store reconstituted peptides at 2–8°C.
-
Discard after 14 days.
-
For long-term storage, aliquot and freeze at -20°C.
-
Avoid repeated freeze-thaw cycles.
-
-
Reconstitution: Reconstitute using sterile bacteriostatic water or a suitable buffer based on experimental protocols.
Legal & Safety Notice:
This product is strictly intended for in vitro research and laboratory use only. It is not intended for human ingestion, therapeutic use, or any in vivo applications in humans or animals.
By purchasing this product, the customer acknowledges that it will be handled only by qualified professionals who are familiar with the risks, safety procedures, and regulatory compliance associated with handling research chemicals.
For Research Use Only. Not for Human or Veterinary Use. Not for Diagnostic or Therapeutic Applications.
All UK orders are shipped with Royal Mail Tracked 24 Signed For, order before 11am on weekdays to get your order the next day!
All US orders are sent on express delivery, which usually takes 3-5 days (however please allow 1-2 weeks for any delays out of our control e.g. customs).
Unfortunately, due to the nature of the product, we do not accept returns.

10mg WOLVERINE STACK - BPC1...
1Get notified when this item is back in stock
Great product, fast delivery and very decent pricing !
Liked eveything
Excellent customer service and product
Company was easy to deal with, an error in the package I received was dealt with within the week. So great products and amazing customer service.
10mg WOLVERINE STACK - BPC157 & TB500 10mg Injectable Peptide Bundle